![[KO Validated] RBM3 Rabbit pAb (A19967)](/upload/resize_cache/iblock/a0d/340_340_140cd750bba9870f18aada2478b24840a/h240pywm5mg458mbv611x9wgspt0is18.jpg "[KO Validated] RBM3 Rabbit pAb (A19967)")
быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
[KO Validated] RBM3 Rabbit pAb (A19967)
- Описание
- Характеристики
-
Overview
Product name [KO Validated] RBM3 Rabbit pAb Catalog No. A19967 Host species Rabbit Purification method Affinity purification Isotype IgG Background
This gene is a member of the glycine-rich RNA-binding protein family and encodes a protein with one RNA recognition motif (RRM) domain. Expression of this gene is induced by cold shock and low oxygen tension. A pseudogene exists on chromosome 1. Multiple alternatively spliced transcript variants that are predicted to encode different isoforms have been characterized although some of these variants fit nonsense-mediated decay (NMD) criteria.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-157 of human RBM3 (NP_006734.1). Sequence MSSEEGKLFVGGLNFNTDEQALEDHFSSFGPISEVVVVKDRETQRSRGFGFITFTNPEHASVAMRAMNGESLDGRQIRVDHAGKSARGTRGGGFGAHGRGRSYSRGGGDQGYGSGRYYDSRPGGYGYGYGRSRDYNGRNQGGYDRYSGGNYRDNYDN Gene ID Swiss Prot Synonyms RNPL; IS1-RNPL Calculated MW 17kDa Observed MW 17kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IF/ICC Recommended dilution - WB 1:200 - 1:2000
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples 293T Cellular location Cell projection, Cytoplasm, Nucleus, dendrite 
Western blot analysis of extracts from normal (control) and RBM3 knockout (KO) 293T cells, using RBM3 antibody (A19967) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min. -
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-157 of human RBM3 (NP_006734.1). KO Validated Validated Isotype IgG