![[KO Validated] TRMT2A/HTF9C Rabbit pAb (A19987)](/upload/resize_cache/iblock/ef4/340_340_140cd750bba9870f18aada2478b24840a/yd7ye18qgpsgcw4bmszj9onf8dqs24rc.jpg "[KO Validated] TRMT2A/HTF9C Rabbit pAb (A19987)")
быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
[KO Validated] TRMT2A/HTF9C Rabbit pAb (A19987)
- Описание
- Характеристики
-
Overview
Product name [KO Validated] TRMT2A/HTF9C Rabbit pAb Catalog No. A19987 Host species Rabbit Purification method Affinity purification Isotype IgG Background
The protein encoded by this gene is of unknown function. However, it is orthologous to the mouse Trmt2a gene and contains an RNA methyltransferase domain. Expression of this gene varies during the cell cycle, with aberrant expression being a possible biomarker in certain breast cancers. Several transcript variants encoding two different isoforms have been found for this gene.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 500 to the C-terminus of human TRMT2A/HTF9C (NP_073564.3). Sequence LASQHLVAILDPPRAGLHSKVILAIRRAKNLRRLLYVSCNPRAAMGNFVDLCRAPSNRVKGIPFRPVKAVAVDLFPQTPHCEMLILFERVEHPNGTGVLGPHSPPAQPTPGPPDNTLQETGTFPSS Gene ID Swiss Prot Synonyms HTF9C Calculated MW 69kDa Observed MW 80kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.Key application Western blotting Positive samples HeLa Cellular location cytosol 
Western blot analysis of extracts from normal (control) and TRMT2A/HTF9C knockout (KO) HeLa cells, using TRMT2A/HTF9C antibody (A19987) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 500 to the C-terminus of human TRMT2A/HTF9C (NP_073564.3). KO Validated Validated Isotype IgG