+7-495-308-45-67 Заказать звонок

[KO Validated] TRIM25 Rabbit mAb (A4347)

быстрая доставка ~4 недели

Размер

100 μL
200 μL
50 μL

Описание
Характеристики

Overview

Product name	[KO Validated] TRIM25 Rabbit mAb
Catalog No.	A4347
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC0971

Background

The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein is an RNA binding protein, functions as a ubiquitin E3 ligase and is involved in multiple cellular processes, including regulation of antiviral innate immunity.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 100-200 of human TRIM25 (Q14258).
Sequence	SPNAQVACDHCLKEAAVKTCLVCMASFCQEHLQPHFDSPAFQDHPLQPPVRDLLRRKCSQHNRLREFFCPEHSECICHICLVEHKTCSPASLSQASADLEA
Gene ID
Swiss Prot
Synonyms	EFP; Z147; RNF147; ZNF147
Calculated MW	71kDa
Observed MW	70kDa

Applications

Reactivity	Human
Tested applications	WB
Recommended dilution	WB 1:500 - 1:1000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	293T
Cellular location	Cytoplasm

Western blot analysis of extracts from wild type(WT) and TRIM25 knockout (KO) 293T(KO) cells, using TRIM25 antibody (A4347) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.

Key applications	Western blotting
Host species	Кролик
Antibody type	Primary Antibodies
Reactivity	Человек
Immunogen	A synthetic peptide corresponding to a sequence within amino acids 100-200 of human TRIM25 (Q14258).
KO Validated	Validated
Isotype	IgG