![[KO Validated] S100A11 Rabbit pAb (A5486)](/upload/resize_cache/iblock/337/340_340_140cd750bba9870f18aada2478b24840a/hv6gvlzfn0mkmnp5tn0725bjzvbdp1ar.jpg "[KO Validated] S100A11 Rabbit pAb (A5486)")
быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
[KO Validated] S100A11 Rabbit pAb (A5486)
- Описание
- Характеристики
-
Overview
Product name [KO Validated] S100A11 Rabbit pAb Catalog No. A5486 Host species Rabbit Purification method Affinity purification Isotype IgG Background
The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in motility, invasion, and tubulin polymerization. Chromosomal rearrangements and altered expression of this gene have been implicated in tumor metastasis.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-105 of human S100A11 (NP_005611.1). Sequence MAKISSPTETERCIESLIAVFQKYAGKDGYNYTLSKTEFLSFMNTELAAFTKNQKDPGVLDRMMKKLDTNSDGQLDFSEFLNLIGGLAMACHDSFLKAVPSQKRT Gene ID Swiss Prot Synonyms MLN70; S100C; HEL-S-43 Calculated MW 12kDa Observed MW 12kDa Applications
Reactivity Human Tested applications WB IF/ICC IP Recommended dilution - WB 1:500 - 1:2000
- IF/ICC 1:50 - 1:200
- IP 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Immunoprecipitation Positive samples BxPC-3, BT-474, LOVO, 22Rv1, SKOV3, THP-1 Cellular location Cytoplasm, Nucleus 
Western blot analysis of extracts of various cell lines, using S100A11 antibody (A5486) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Western blot analysis of extracts from normal (control) and S100A11 knockout (KO) HeLa cells, using S100A11 antibody (A5486) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Immunofluorescence analysis of U2OS cells using S100A11 antibody (A5486). Blue: DAPI for nuclear staining.
Immunoprecipitation analysis of 200 μg extracts of THP-1 cells using 3 μg S100A11 antibody (A5486). Western blot was performed from the immunoprecipitate using S100A11 antibody (A5486) at a dilution of 1:1000.
-
Key applications Western blotting, Immunofluorescence, Immunoprecipitation Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-105 of human S100A11 (NP_005611.1). KO Validated Validated Isotype IgG