![[KO Validated] POLE3 Rabbit pAb (A6469)](/upload/resize_cache/iblock/170/340_340_140cd750bba9870f18aada2478b24840a/g25pfbnhrrsavfxvxp2mz3bq7c1l7093.jpg "[KO Validated] POLE3 Rabbit pAb (A6469)")
быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
[KO Validated] POLE3 Rabbit pAb (A6469)
- Описание
- Характеристики
-
Overview
Product name [KO Validated] POLE3 Rabbit pAb Catalog No. A6469 Host species Rabbit Purification method Affinity purification Isotype IgG Background
POLE3 is a histone-fold protein that interacts with other histone-fold proteins to bind DNA in a sequence-independent manner. These histone-fold protein dimers combine within larger enzymatic complexes for DNA transcription, replication, and packaging.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-147 of human POLE3 (NP_059139.3). Sequence MAERPEDLNLPNAVITRIIKEALPDGVNISKEARSAISRAASVFVLYATSCANNFAMKGKRKTLNASDVLSAMEEMEFQRFVTPLKEALEAYRREQKGKKEASEQKKKDKDKKTDSEEQDKSRDEDNDEDEERLEEEEQNEEEEVDN Gene ID Swiss Prot Synonyms p17; YBL1; CHRAC2; CHRAC17; CHARAC17 Calculated MW 17kDa Observed MW 20-25kDa Applications
Reactivity Human, Mouse Tested applications WB Recommended dilution - WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.Key application Western blotting Positive samples HepG2, Mouse testis, Mouse bone marrow, Mouse spleen, 293T Cellular location Nucleus Customer validation IF(Homo sapiens)
WB(Mus musculus)
Western blot analysis of extracts of various cell lines, using POLE3 antibody (A6469) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.
Western blot analysis of extracts from normal (control) and [KO Validated] POLE3 Rabbit pAb knockout (KO) 293T cells, using [KO Validated] POLE3 Rabbit pAb antibody (A6469) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-147 of human POLE3 (NP_059139.3). KO Validated Validated Isotype IgG