быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
ACTN3 Rabbit mAb (A19631)
- Описание
- Характеристики
-
Overview
Product name ACTN3 Rabbit mAb Catalog No. A19631 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2202 Background
This gene encodes a member of the alpha-actin binding protein gene family. The encoded protein is primarily expressed in skeletal muscle and functions as a structural component of sarcomeric Z line. This protein is involved in crosslinking actin containing thin filaments. An allelic polymorphism in this gene results in both coding and non-coding variants; the reference genome represents the coding allele. The non-functional allele of this gene is associated with elite athlete status.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 700-800 of human ACTN3 (Q08043). Sequence DRLEGDHQLLQESLVFDNKHTVYSMEHIRVGWEQLLTSIARTINEVENQVLTRDAKGLSQEQLNEFRASFNHFDRKQNGMMEPDDFRACLISMGYDLGEVE Gene ID Swiss Prot Synonyms ACTN3D Calculated MW 103kDa Observed MW 103kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IF/ICC Recommended dilution - WB 1:500 - 1:1000
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples Mouse skeletal muscle, Rat skeletal muscle Cellular location Cortical actin cytoskeleton, Cytosol, Extracellular exosome, Plasma membrane, Z disc 
Western blot analysis of extracts of various cell lines, using ACTN3 Rabbit mAb (A19631) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
Immunofluorescence analysis of rat bone marrow cells using ACTN3 Rabbit mAb (A19631) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of mouse bone marrow cells using ACTN3 Rabbit mAb (A19631) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 700-800 of human ACTN3 (Q08043). Isotype IgG