![[KD Validated] DNMT1 Rabbit mAb (A19679)](/upload/resize_cache/iblock/52f/340_340_140cd750bba9870f18aada2478b24840a/ex21xu1ks0mtfmzbt0mjx336fwptem4v.jpg "[KD Validated] DNMT1 Rabbit mAb (A19679)")
быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
[KD Validated] DNMT1 Rabbit mAb (A19679)
- Описание
- Характеристики
-
Overview
Product name [KD Validated] DNMT1 Rabbit mAb Catalog No. A19679 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC51348 Background
This gene encodes an enzyme that transfers methyl groups to cytosine nucleotides of genomic DNA. This protein is the major enzyme responsible for maintaining methylation patterns following DNA replication and shows a preference for hemi-methylated DNA. Methylation of DNA is an important component of mammalian epigenetic gene regulation. Aberrant methylation patterns are found in human tumors and associated with developmental abnormalities. Variation in this gene has been associated with cerebellar ataxia, deafness, and narcolepsy, and neuropathy, hereditary sensory, type IE. Alternative splicing results in multiple transcript variants.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human DNMT1 (NP_001370.1). Sequence MPARTAPARVPTLAVPAISLPDDVRRRLKDLERDSLTEKECVKEKLNLLHEFLQTEIKNQLCDLETKLRKEELSEEGYLAKVKSLLNKDLSLENGAHAYN Gene ID Swiss Prot Synonyms AIM; DNMT; MCMT; CXXC9; HSN1E; ADCADN; m.HsaI Calculated MW 183kDa Observed MW 200kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IP Recommended dilution - WB 1:500 - 1:1000
- IP 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunoprecipitation Positive samples Jurkat, HeLa, 293T Cellular location Nucleus Customer validation IF(Mus musculus)
WB(Gallus gallus)
Western blot analysis of extracts of various cell lines, using DNMT1 antibody (A19679) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.
Western blot analysis of extracts from wild type (WT) and DNMT1 knockdown (KD) 293T cells, using DNMT1 antibody (A19679) at1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
Immunoprecipitation analysis of 300 μg extracts from Jurkat cells using 3 μg [KD Validated] DNMT1 Rabbit mAb (A19679).Western blot was performed from the immunoprecipitate using DNMT1 (A19679) at a dilution of 1:1000.
Chromatin immunoprecipitation analysis of extracts of HeLa cells, using DNMT1 antibody (A19679) and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.
-
Key applications Western blotting, Immunoprecipitation Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human DNMT1 (NP_001370.1). Isotype IgG