![[KD Validated] Aurora B Rabbit mAb (A21918)](/upload/resize_cache/iblock/376/340_340_140cd750bba9870f18aada2478b24840a/ila9mnxzhfrkeuvfqzlpbm3099q2yd18.jpg "[KD Validated] Aurora B Rabbit mAb (A21918)")
быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
[KD Validated] Aurora B Rabbit mAb (A21918)
- Описание
- Характеристики
-
Overview
Product name [KD Validated] Aurora B Rabbit mAb Catalog No. A21918 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC50892 Background
This gene encodes a member of the aurora kinase subfamily of serine/threonine kinases. The genes encoding the other two members of this subfamily are located on chromosomes 19 and 20. These kinases participate in the regulation of alignment and segregation of chromosomes during mitosis and meiosis through association with microtubules. A pseudogene of this gene is located on chromosome 8. Alternatively spliced transcript variants have been found for this gene.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Aurora B (NP_004208.2). Sequence MAQKENSYPWPYGRQTAPSGLSTLPQRVLRKEPVTPSALVLMSRSNVQPTAAPGQKVMENSSGTPDILTRHFTIDDFEIGRPLGKGKFGNVYLAREKKSH Gene ID Swiss Prot Synonyms AIK2; AIM1; ARK2; AurB; IPL1; STK5; AIM-1; ARK-2; STK-1; STK12; PPP1R48; aurkb-sv1; aurkb-sv2 Calculated MW 39kDa Observed MW 39kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IF/ICC Recommended dilution - WB 1:500 - 1:1000
- IF/ICC 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples Jurkat, NIH/3T3, C6, 293T Cellular location Chromosome, Cytoplasm, Midbody, Nucleus, centromere, cytoskeleton, spindle 
Western blot analysis of extracts of Jurkat cells, using Aurora B antibody (A21918) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
Western blot analysis of extracts of various cell lines, using Aurora B antibody (A21918) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
Western blot analysis of extracts from wild type(WT) and Aurora B knockdown (KD) 293T cells, using Aurora B antibody (A21918) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
Immunofluorescence analysis of C6 cells using [KD Validated] Aurora B Rabbit mAb (A21918) at dilution of 1:1000 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Aurora B (NP_004208.2). Isotype IgG