![[KD Validated] Ajuba Rabbit mAb (A22039)](/upload/resize_cache/iblock/4a6/340_340_140cd750bba9870f18aada2478b24840a/qvjsxka7q72gy8ebryo8r7n0xzxzx5v0.jpg "[KD Validated] Ajuba Rabbit mAb (A22039)")
быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
[KD Validated] Ajuba Rabbit mAb (A22039)
- Описание
- Характеристики
-
Overview
Product name [KD Validated] Ajuba Rabbit mAb Catalog No. A22039 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC54979 Background
Enables alpha-catenin binding activity and transcription corepressor activity. Involved in several processes, including negative regulation of hippo signaling; positive regulation of gene silencing by miRNA; and regulation of cellular response to hypoxia. Acts upstream of or within gene silencing by miRNA and positive regulation of protein-containing complex assembly. Located in several cellular components, including Golgi apparatus; P-body; and nucleoplasm.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 201-290 of human Ajuba (NP_116265.1). Sequence PSAYPELHAALDRLYAQRPAGFGCQESRHSYPPALGSPGALAGAGVGAAGPLERRGAQPGRHSVTGYGDCAVGARYQDELTALLRLTVGT Gene ID Swiss Prot Synonyms JUB Calculated MW 57kDa Observed MW 55kDa Applications
Reactivity Human, Rat Tested applications WB IP Recommended dilution - WB 1:2000 - 1:20000
- IP 1:10000 - 1:90000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunoprecipitation Positive samples HepG2, Rat lung Cellular location adherens junction, cell-cell junction, cytosol, Golgi apparatus, microtubule organizing center, nucleoplasm, nucleus, P-body, plasma membrane 
Western blot analysis of extracts of various cell lines, using Ajuba antibody (A22039) at1:20000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.
Western blot analysis of extracts from wild type (WT) and Ajuba knockdown (KD) HepG2 cells, using Ajuba antibody (A22039) at1:20000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
Immunoprecipitation analysis of 300 μg extracts of HepG2 cells using 3 μg Ajuba antibody (A22039). Western blot was performed from the immunoprecipitate using Ajuba (A22039) at a dilution of 1:80000.
-
Key applications Western blotting, Immunoprecipitation Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 201-290 of human Ajuba (NP_116265.1). Isotype IgG