быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
ACSL3 Rabbit mAb (A22085)
- Описание
- Характеристики
-
Overview
Product name ACSL3 Rabbit mAb Catalog No. A22085 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC55219 Background
The protein encoded by this gene is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. This isozyme is highly expressed in brain, and preferentially utilizes myristate, arachidonate, and eicosapentaenoate as substrates. The amino acid sequence of this isozyme is 92% identical to that of rat homolog. Two transcript variants encoding the same protein have been found for this gene.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 600-700 of human ACSL3 (NP_004448.2). Sequence ALKNLPLVDNICAYANSYHSYVIGFVVPNQKELTELARKKGLKGTWEELCNSCEMENEVLKVLSEAAISASLEKFEIPVKIRLSPEPWTPETGLVTDAFKL Gene ID Swiss Prot Synonyms ACS3; FACL3; LACS3; LACS 3; PRO2194 Calculated MW 80kDa Observed MW 75kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IF/ICC Recommended dilution - WB 1:10000 - 1:30000
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples K-562, HeLa, Mouse spinal cord, Rat brain Cellular location Endoplasmic reticulum membrane, Microsome membrane, Mitochondrion outer membrane, Peroxisome membrane, Single-pass type III membrane protein 
Western blot analysis of extracts of various cell lines, using ACSL3 antibody (A22085) at1:30000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.
Western blot analysis of extracts of various cell lines, using ACSL3 antibody (A22085) at1:30000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.
Confocal imaging of K-562 cells using ACSL3 Rabbit mAb (A22085, dilution 1:200)(Red).DAPI was used for nuclear staining (blue). Objective: 100x.
-
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 600-700 of human ACSL3 (NP_004448.2). Isotype IgG