быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
4-1BB/CD137 Rabbit mAb (A22167)
- Описание
- Характеристики
-
Overview
Product name 4-1BB/CD137 Rabbit mAb Catalog No. A22167 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC55368 Background
The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor contributes to the clonal expansion, survival, and development of T cells. It can also induce proliferation in peripheral monocytes, enhance T cell apoptosis induced by TCR/CD3 triggered activation, and regulate CD28 co-stimulation to promote Th1 cell responses. The expression of this receptor is induced by lymphocyte activation. TRAF adaptor proteins have been shown to bind to this receptor and transduce the signals leading to activation of NF-kappaB.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 24-186 of human 4-1BB/CD137 (NP_001552.2). Sequence LQDPCSNCPAGTFCDNNRNQICSPCPPNSFSSAGGQRTCDICRQCKGVFRTRKECSSTSNAECDCTPGFHCLGAGCSMCEQDCKQGQELTKKGCKDCCFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSVTPPAPAREPGHSPQ Gene ID Swiss Prot Synonyms ILA; 4-1BB; CD137; CDw137; IMD109 Calculated MW 28kDa Observed MW 24-28kDa 40-50kDa Applications
Reactivity Human Tested applications WB Recommended dilution - WB 1:2000 - 1:20000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples 293T-4-1BB/CD137 Cellular location Membrane, Single-pass type I membrane protein 
Western blot analysis of 293T, using 4-1BB/CD137 antibody (A22167) at1:20000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 24-186 of human 4-1BB/CD137 (NP_001552.2). Isotype IgG