быстрая доставка ~4 недели
Размер
- 100 T
- 200 T
- 500 T
ABflo® 647 Rabbit anti-Mouse Ly-6G mAb (A22585)
- Описание
- Характеристики
-
Overview
Product name ABflo® 647 Rabbit anti-Mouse Ly-6G mAb Catalog No. A22585 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC55435-ABf647 Background
Located in external side of plasma membrane.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 27-105 of mouse Ly-6G (NP_001297367.1). Sequence LECYNCIGVPPETSCNTTTCPFSDGFCVALEIEVIVDSHRSKVKSNLCLPICPTTLDNTEITGNAVNVKTYCCKEDLCN Gene ID Swiss Prot Synonyms Gr1; Gr-1; Ly-6G Calculated MW 28kDa Observed MW Refer to figures Applications
Reactivity Mouse Tested applications IF/ICC FC Recommended dilution - FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.03% proclin300, 0.2% BSA, 50% glycerol, pH7.3.Key application Flow Cytometry Immunofluorescence Positive samples Cellular location cell surface, endosome, extracellular space, nuclear membrane, plasma membrane 
Immunofluorescence analysis of Ly-6G-293F transfected and control 293F cells using ABflo® 647 Rabbit anti-Mouse Ly-6G mAb (A22585) at dilution of 1:300 (40xlens). Blue: DAPI for nuclear staining.

Flow cytometry:1X10^6 293F cells (negative control, Left) and 293F(Transfection, right) cells were surface-stained with ABflo® 647 Rabbit anti-Mouse Ly-6G mAb(AA22585, 5 μl/Test, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry:1X10^6 293F(Transfection) cells were surface-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, left) or ABflo® 647 Rabbit anti-Mouse Ly-6G mAb(A22585, 5 μl/Test, right).
-
Key applications Flow Cytometry, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Мышь Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 27-105 of mouse Ly-6G (NP_001297367.1). Isotype IgG







