быстрая доставка ~4 недели
Размер
- 100 T
- 200 T
- 500 T
ABflo® 488 Rabbit anti-Human CD59 mAb (A22588)
- Описание
- Характеристики
-
Overview
Product name ABflo® 488 Rabbit anti-Human CD59 mAb Catalog No. A22588 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC56720-ABf488 Background
This gene encodes a cell surface glycoprotein that regulates complement-mediated cell lysis, and it is involved in lymphocyte signal transduction. This protein is a potent inhibitor of the complement membrane attack complex, whereby it binds complement C8 and/or C9 during the assembly of this complex, thereby inhibiting the incorporation of multiple copies of C9 into the complex, which is necessary for osmolytic pore formation. This protein also plays a role in signal transduction pathways in the activation of T cells. Mutations in this gene cause CD59 deficiency, a disease resulting in hemolytic anemia and thrombosis, and which causes cerebral infarction. Multiple alternatively spliced transcript variants, which encode the same protein, have been identified for this gene.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 26-101 of human CD59 (NP_000602.1). Sequence LQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLE Gene ID Swiss Prot Synonyms 1F5; EJ16; EJ30; EL32; G344; MIN1; MIN2; MIN3; MIRL; HRF20; MACIF; MEM43; MIC11; MSK21; 16.3A5; HRF-20; MAC-IP; p18-20 Calculated MW 14kDa Observed MW Applications
Reactivity Human Tested applications FC Recommended dilution - FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.03% proclin300, 0.2% BSA, 50% glycerol, pH7.3.Key application Flow Cytometry Positive samples Cellular location Cell surface, External side of plasma membrane, Extracellular exosome, Extracellular space, Focal adhesion, Plasma membrane 
Flow cytometry:1X10^6 U937 cells (Low Expression, Left) and HEL cells (Right) were surface-stained with ABflo® 488 Rabbit anti-Human CD59 mAb(A22588, 5 μl/Test, orange line) or ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry:1X10^6 Jurkat cells were surface-stained with ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, left) or ABflo® 488 Rabbit anti-Human CD59 mAb(A22588, 5 μl/Test, right).
-
Key applications Flow Cytometry Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 26-101 of human CD59 (NP_000602.1). Isotype IgG







