быстрая доставка ~4 недели
Размер
- 100 T
- 200 T
- 500 T
ABflo® 488 Rabbit anti-Human Glypican 3 (GPC3) mAb (A22631)
- Описание
- Характеристики
-
Overview
Product name ABflo® 488 Rabbit anti-Human Glypican 3 (GPC3) mAb Catalog No. A22631 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC56916-ABf488 Background
Cell surface heparan sulfate proteoglycans are composed of a membrane-associated protein core substituted with a variable number of heparan sulfate chains. Members of the glypican-related integral membrane proteoglycan family (GRIPS) contain a core protein anchored to the cytoplasmic membrane via a glycosyl phosphatidylinositol linkage. These proteins may play a role in the control of cell division and growth regulation. The protein encoded by this gene can bind to and inhibit the dipeptidyl peptidase activity of CD26, and it can induce apoptosis in certain cell types. Deletion mutations in this gene are associated with Simpson-Golabi-Behmel syndrome, also known as Simpson dysmorphia syndrome. Alternative splicing results in multiple transcript variants.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 480-580 of human GPC3 (NP_004475.1). Sequence KGRVLDKNLDEEGFESGDCGDDEDECIGGSGDGMIKVKNQLRFLAELAYDLDVDDAPGNSQQATPKDNEISTFHNLGNVHSPLKLLTSMAISVVCFFFLVH Gene ID Swiss Prot Synonyms SGB; DGSX; MXR7; SDYS; SGBS; OCI-5; SGBS1; GTR2-2 Calculated MW 59kDa/65kDa/68kDa Observed MW Refer to figures Applications
Reactivity Human Tested applications FC Recommended dilution - FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.03% proclin300, 0.2% BSA, 50% glycerol, pH7.3.Key application Flow Cytometry Positive samples Cellular location Cell membrane, Lipid-anchor, GPI-anchor 
Flow cytometry:1X10^6 K-562 cells (negative control, Left) and HepG2 cells (Right) were surface-stained with ABflo® 488 Rabbit anti-Human Glypican 3 (GPC3) mAb(A22631, 5 μl/Test, orange line) or ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).
Flow cytometry:1X10^6 HepG2 cells were surface-stained with ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, left) or ABflo® 488 Rabbit anti-Human Glypican 3 (GPC3) mAb(A22631, 5 μl/Test, right).
-
Key applications Flow Cytometry Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen A synthetic peptide corresponding to a sequence within amino acids 480-580 of human GPC3 (NP_004475.1). Isotype IgG