быстрая доставка ~4 недели
Размер
- 100 T
- 200 T
- 500 T
ABflo® 647 Rabbit anti-Human CD40 mAb (A22642)
- Описание
- Характеристики
-
Overview
Product name ABflo® 647 Rabbit anti-Human CD40 mAb Catalog No. A22642 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC57632-ABf647 Background
This gene is a member of the TNF-receptor superfamily. The encoded protein is a receptor on antigen-presenting cells of the immune system and is essential for mediating a broad variety of immune and inflammatory responses including T cell-dependent immunoglobulin class switching, memory B cell development, and germinal center formation. AT-hook transcription factor AKNA is reported to coordinately regulate the expression of this receptor and its ligand, which may be important for homotypic cell interactions. Adaptor protein TNFR2 interacts with this receptor and serves as a mediator of the signal transduction. The interaction of this receptor and its ligand is found to be necessary for amyloid-beta-induced microglial activation, and thus is thought to be an early event in Alzheimer disease pathogenesis. Mutations affecting this gene are the cause of autosomal recessive hyper-IgM immunodeficiency type 3 (HIGM3). Multiple alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 21-193 of human CD40 (NP_001241.1). Sequence EPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLR Gene ID Swiss Prot Synonyms p50; Bp50; CDW40; TNFRSF5 Calculated MW 31kDa Observed MW Refer to figures Applications
Reactivity Human Tested applications FC Recommended dilution - FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.03% proclin300, 0.2% BSA, 50% glycerol, pH7.3.Key application Flow Cytometry Positive samples Cellular location Cell membrane, Single-pass type I membrane protein, Secreted 
Flow cytometry:1X10^6 Jurkat cells (negative control, Left) and U-2OS cells (Right) were surface-stained with ABflo® 647 Rabbit anti-Human CD40 mAb(A22642, 5 μl/Test, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry:1X10^6 U-2OS cells were surface-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, left) or ABflo® 647 Rabbit anti-Human CD40 mAb(A22642, 5 μl/Test, right).
-
Key applications Flow Cytometry Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 21-193 of human CD40 (NP_001241.1). Isotype IgG







