быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Activator protein 2 (AP-2/TFAP2A) Rabbit mAb (A2294)
- Описание
- Характеристики
-
Overview
Product name Activator protein 2 (AP-2/TFAP2A) Rabbit mAb Catalog No. A2294 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1905 Background
The protein encoded by this gene is a transcription factor that binds the consensus sequence 5'-GCCNNNGGC-3'. The encoded protein functions as either a homodimer or as a heterodimer with similar family members. This protein activates the transcription of some genes while inhibiting the transcription of others. Defects in this gene are a cause of branchiooculofacial syndrome (BOFS). Three transcript variants encoding different isoforms have been found for this gene.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 50-150 of human Activator protein 2 (AP-2/TFAP2A) (P05549). Sequence NADFQPPYFPPPYQPIYPQSQDPYSHVNDPYSLNPLHAQPQPQHPGWPGQRQSQESGLLHTHRGLPHQLSGLDPRRDYRRHEDLLHGPHALSSGLGDLSIH Gene ID Swiss Prot Synonyms AP-2; BOFS; AP2TF; TFAP2; AP-2alpha Calculated MW 48kDa Observed MW 48kDa Applications
Reactivity Human, Mouse Tested applications WB Recommended dilution - WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples HeLa, PC-3, NIH/3T3 Cellular location Nucleus 
Western blot analysis of extracts of various cell lines, using Activator protein 2 (AP-2/TFAP2A) Rabbit mAb (A2294) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь Immunogen A synthetic peptide corresponding to a sequence within amino acids 50-150 of human Activator protein 2 (AP-2/TFAP2A) (P05549). Isotype IgG







