быстрая доставка ~4 недели
Размер
- 100 T
- 200 T
- 500 T
ABflo® 488 Rabbit anti-Pig CD8A mAb (A23010)
- Описание
- Характеристики
-
Overview
Product name ABflo® 488 Rabbit anti-Pig CD8A mAb Catalog No. A23010 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC57970-ABf488 Background
The CD8 antigen is a cell surface glycoprotein found on most cytotoxic T lymphocytes that mediates efficient cell-cell interactions within the immune system. The CD8 antigen acts as a coreceptor with the T-cell receptor on the T lymphocyte to recognize antigens displayed by an antigen presenting cell in the context of class I MHC molecules. The coreceptor functions as either a homodimer composed of two alpha chains or as a heterodimer composed of one alpha and one beta chain. Both alpha and beta chains share significant homology to immunoglobulin variable light chains. This gene encodes the CD8 alpha chain. Multiple transcript variants encoding different isoforms have been found for this gene. The major protein isoforms of this gene differ by the presence or absence of a transmembrane domain and thus differ in being a membrane-anchored or secreted protein.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 25-184 of pig CD8A(XP_005662451.1) Sequence SLFRTSPEMVQASLGETVKLRCEVMHSNTLTSCSWLYQKPGAASKPIFLMYLSKTRNKTAEGLDTRYISGYKANDNFYLILHRFREEDQGYYFCSFLSNSVLYFSNFMSVFLPAKPTKTPTTPPPKRTPTKASHAVSVAPEVCRPSGNAVDPRKLDFAC Gene ID Swiss Prot Synonyms Calculated MW 26kDa Observed MW Applications
Reactivity Pig Tested applications FC Recommended dilution - FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.03% proclin300, 0.2% BSA, 50% glycerol, pH7.3.Key application Flow Cytometry Positive samples Cellular location 
Flow cytometry:1X10^6 293F cells (negative control, Left) and 293F(Transfection, right) cells were surface-stained with ABflo® 488 Rabbit anti-Pig CD8A mAb(A23010, 5 μl/Test, orange line) or ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, blue line). Non-fluorescently stained cells was used as blank control (red line).
Flow cytometry:1X10^6 293F(Transfection) cells were surface-stained with ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, left) or ABflo® 488 Rabbit anti-Pig CD8A mAb(A23010, 5 μl/Test, right).
-
Key applications Flow Cytometry Host species Кролик Antibody type Primary Antibodies Reactivity Свинья Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 25-184 of pig CD8A(XP_005662451.1) Isotype IgG