быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
ADAMTS5 Rabbit mAb (A23125)
- Описание
- Характеристики
-
Overview
Product name ADAMTS5 Rabbit mAb Catalog No. A23125 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC59326 Background
This gene encodes a member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motifs) protein family. Members of the family share several distinct protein modules, including a propeptide region, a metalloproteinase domain, a disintegrin-like domain, and a thrombospondin type 1 (TS) motif. Individual members of this family differ in the number of C-terminal TS motifs, and some have unique C-terminal domains. The encoded preproprotein is proteolytically processed to generate the mature enzyme. This enzyme contains two C-terminal TS motifs and functions as an aggrecanase that cleaves aggrecan, a major proteoglycan of cartilage, and may mediate cartilage destruction in osteoarthritis.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 601-700 of human ADAMTS5 (NP_008969.2). Sequence NNGRYCTGKRAIYRSCSLMPCPPNGKSFRHEQCEAKNGYQSDAKGVKTFVEWVPKYAGVLPADVCKLTCRAKGTGYYVVFSPKVTDGTECRLYSNSVCVR Gene ID Swiss Prot Synonyms ADMP-2; ADAM-TS5; ADAMTS-5; ADAMTS11; ADAM-TS 5; ADAMTS-11; ADAM-TS 11 Calculated MW 102kDa Observed MW 76kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:1000 - 1:5000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples HeLa, Mouse ovary Cellular location Secreted, extracellular matrix, extracellular space 
Western blot analysis of various lysates, using ADAMTS5 antibody (A23125) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 601-700 of human ADAMTS5 (NP_008969.2). Isotype IgG







