![[KO/KD Validated] CD90/Thy1 Rabbit mAb (A23224)](/upload/resize_cache/iblock/112/340_340_140cd750bba9870f18aada2478b24840a/0ckp0tk0ww84ypu7yejezzquc5gi7vjb.jpg "[KO/KD Validated] CD90/Thy1 Rabbit mAb (A23224)")
быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
[KO/KD Validated] CD90/Thy1 Rabbit mAb (A23224)
- Описание
- Характеристики
-
Overview
Product name [KO/KD Validated] CD90/Thy1 Rabbit mAb Catalog No. A23224 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC55647 Background
This gene encodes a cell surface glycoprotein and member of the immunoglobulin superfamily of proteins. The encoded protein is involved in cell adhesion and cell communication in numerous cell types, but particularly in cells of the immune and nervous systems. The encoded protein is widely used as a marker for hematopoietic stem cells. This gene may function as a tumor suppressor in nasopharyngeal carcinoma. Alternative splicing results in multiple transcript variants.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 20-130 of human CD90/Thy1 (NP_006279.2). Sequence QKVTSLTACLVDQSLRLDCRHENTSSSPIQYEFSLTRETKKHVLFGTVGVPEHTYRSRTNFTSKYNMKVLYLSAFTSKDEGTYTCALHHSGHSPPISSQNVTVLRDKLVKC Gene ID Swiss Prot Synonyms CD90; CDw90 Calculated MW 18kDa Observed MW 22-30kDa Applications
Reactivity Human Tested applications WB Recommended dilution - WB 1:2000 - 1:20000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples U-251 MG, U-2 OS WT Cellular location Cell membrane, GPI-anchor, Lipid-anchor 
Western blot analysis of U-251 MG, using CD90/Thy1 Rabbit mAb (A23224) at 1:20000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.
Western blot analysis of extracts from wild type(WT) and CD90/Thy1 Rabbit mAb knockdown (KD) U-2 OS(KD) cells, using CD90/Thy1 Rabbit mAb (A23224) at 1:20000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 20-130 of human CD90/Thy1 (NP_006279.2). Isotype IgG