быстрая доставка ~4 недели
Размер
- 100 T
- 200 T
- 500 T
ABflo® 488 Rabbit anti-Human Ki67 mAb (A23407)
- Описание
- Характеристики
-
Overview
Product name ABflo® 488 Rabbit anti-Human Ki67 mAb Catalog No. A23407 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC57564-ABf488 Background
Enables protein C-terminus binding activity. Involved in regulation of chromosome segregation and regulation of mitotic nuclear division. Located in chromosome; nuclear body; and nucleolus. Colocalizes with condensed chromosome. Implicated in Crohn's disease; breast cancer; human immunodeficiency virus infectious disease; and pancreatic cancer. Biomarker of several diseases, including Barrett's esophagus; autoimmune disease of musculoskeletal system (multiple); endocrine gland cancer (multiple); gastrointestinal system cancer (multiple); and interstitial cystitis.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 2245-2345 of human MKI67 (NP_002408.3). Sequence KADVEEESLALRKRTPSVGKAMDTPKPAGGDEKDMKAFMGTPVQKLDLPGNLPGSKRWPQTPKEKAQALEDLAGFKELFQTPGTDKPTTDEKTTKIACKSP Gene ID Swiss Prot Synonyms KIA; MIB-; MIB-1; PPP1R105 Calculated MW 319kDa/359kDa Observed MW Refer to figures Applications
Reactivity Human Tested applications FC FC(Intra) Recommended dilution - FC(Intra) 5 μl per 10^6 cells in 100 μl volume
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.03% proclin300, 0.2% BSA, 50% glycerol, pH7.3.Key application Positive samples Cellular location Chromosome, Nucleus, Nucleolus 
Flow cytometry:1X10^6 knockout (KO) HeLa cells(negative control, left) and Hela cells (right) were intracellularly-stained with ABflo® 488 Rabbit anti-Human Ki67 mAb(A23407, 5 μl/Test, orange line) or ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, blue line).Non-fluorescently stained cells was used as blank control (red line).
Flow cytometry:1X10^6 Hela cells were intracellularly-stained with ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, left) or ABflo® 488 Rabbit anti-Human Ki67 mAb(A23407, 5 μl/Test, right).
-
Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 2245-2345 of human MKI67 (NP_002408.3). Isotype IgG