быстрая доставка ~4 недели
Размер
- 100 T
- 200 T
- 500 T
ABflo® 594 Rabbit anti-Human CD337/NKp30 mAb (A23737)
- Описание
- Характеристики
-
Overview
Product name ABflo® 594 Rabbit anti-Human CD337/NKp30 mAb Catalog No. A23737 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC60018-ABf594 Background
The protein encoded by this gene is a natural cytotoxicity receptor (NCR) that may aid NK cells in the lysis of tumor cells. The encoded protein interacts with CD3-zeta (CD247), a T-cell receptor. A single nucleotide polymorphism in the 5' untranslated region of this gene has been associated with mild malaria suceptibility. Three transcript variants encoding different isoforms have been found for this gene.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 19-135 of human CD337/NKp30 (NP_667341.1). Sequence LWVSQPPEIRTLEGSSAFLPCSFNASQGRLAIGSVTWFRDEVVPGKEVRNGTPEFRGRLAPLASSRFLHDHQAELHIRDVRGHDASIYVCRVEVLGLGVGTGNGTRLVVEKEHPQLG Gene ID Swiss Prot Synonyms NCR3; 1C7; CD337; LY117; MALS; NKp30; natural cytotoxicity triggering receptor 3 Calculated MW 16kDa/17kDa/18kDa/19kDa/20kDa/21kDa Observed MW Applications
Reactivity Human Tested applications FC FC(Intra) Recommended dilution - FC(Intra) 5 μl per 10^6 cells in 100 μl volume
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.03% proclin300, 0.2% BSA, 50% glycerol, pH7.3.Key application Positive samples Cellular location Plasma membrane 
Flow cytometry: 1X10^6 293T cells(Low Expression, left) and 293T(Transfection, right) cells were intracellularly-stained with ABflo® 594 Rabbit anti-Human CD337/NKp30 mAb(A23737, 5 μl/Test, orange line) or ABflo® 594 Rabbit IgG isotype control (5 μl/Test, blue line).Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry:1X10^6 293T(Transfection) cells were intracellularly-stained with ABflo® 594 Rabbit IgG isotype control (5 μl/Test, left) or ABflo® 594 Rabbit anti-Human CD337/NKp30 mAb(A23737, 5 μl/Test, right).
-
Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 19-135 of human CD337/NKp30 (NP_667341.1). Isotype IgG







