быстрая доставка ~4 недели
Размер
- 100 T
- 200 T
- 500 T
ABflo® 594 Rabbit anti-Human CD215/IL-15R alpha mAb (A23849)
- Описание
- Характеристики
-
Overview
Product name ABflo® 594 Rabbit anti-Human CD215/IL-15R alpha mAb Catalog No. A23849 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC55696-ABf594 Background
This gene encodes a cytokine receptor that specifically binds interleukin 15 (IL15) with high affinity. The receptors of IL15 and IL2 share two subunits, IL2R beta and IL2R gamma. This forms the basis of many overlapping biological activities of IL15 and IL2. The protein encoded by this gene is structurally related to IL2R alpha, an additional IL2-specific alpha subunit necessary for high affinity IL2 binding. Unlike IL2RA, IL15RA is capable of binding IL15 with high affinity independent of other subunits, which suggests distinct roles between IL15 and IL2. This receptor is reported to enhance cell proliferation and expression of apoptosis inhibitor BCL2L1/BCL2-XL and BCL2. Multiple alternatively spliced transcript variants of this gene have been reported.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 31-205 of human CD215/IL-15R alpha（NP_002180.1）. Sequence ITCPPPMSVEHADIWVKSYSLYSRERYICNSGFKRKAGTSSLTECVLNKATNVAHWTTPSLKCIRDPALVHQRPAPPSTVTTAGVTPQPESLSPSGKEPAASSPSSNNTAATTAAIVPGSQLMPSKSPSTGTTEISSHESSHGTPSQTTAKNWELTASASHQPPGVYPQGHSDTT Gene ID Swiss Prot Synonyms IL15RA; CD215; interleukin-15 receptor subunit alpha Calculated MW 15-28kDa Observed MW Applications
Reactivity Human Tested applications FC Recommended dilution - FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.03% proclin300, 0.02% BSA, 50% glycerol, pH7.3.Key application Flow Cytometry Positive samples Cellular location Cytoplasmic vesicle membrane, Endoplasmic reticulum membrane, Golgi apparatus membrane, Membrane, Nucleus membrane, Secreted, Single-pass type I membrane protein, Single-pass type I membrane protein, extracellular space 
Flow cytometry: 1X10^6 293F cells(negative control, left) and 293F(Transfection, right) cells were surface-stained with ABflo® 594 Rabbit anti-Human CD215/IL-15R alpha mAb(A23849, 5 μl/Test, orange line) or ABflo® 594 Rabbit IgG isotype control (5 μl/Test, blue line).Non-fluorescently stained cells were used as blank control (red line).
Flow cytometry:1X10^6 293T(Transfection) cells were surface-stained with ABflo® 594 Rabbit IgG isotype control (5 μl/Test, left) or ABflo® 594 Rabbit anti-Human CD215/IL-15R alpha mAb(A23849, 5 μl/Test, right).
-
Key applications Flow Cytometry Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 31-205 of human CD215/IL-15R alpha（NP_002180.1）. Isotype IgG