быстрая доставка ~4 недели
Размер
- 100 T
- 200 T
- 500 T
ABflo® 488 Rabbit anti-Mouse CD8a mAb (A23903)
- Описание
- Характеристики
-
Overview
Product name ABflo® 488 Rabbit anti-Mouse CD8a mAb Catalog No. A23903 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC60677-ABflo488 Background
Enables identical protein binding activity. Acts upstream of or within several processes, including cytotoxic T cell differentiation; defense response to virus; and positive regulation of calcium-mediated signaling. Located in external side of plasma membrane. Is expressed in several structures, including endocrine gland; exocrine gland; genitourinary system; gut; and hemolymphoid system gland. Orthologous to human CD8A (CD8a molecule).Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 28-196 of mouse CD8a (NP_001074579.1). Sequence KPQAPELRIFPKKMDAELGQKVDLVCEVLGSVSQGCSWLFQNSSSKLPQPTFVVYMASSHNKITWDEKLNSSKLFSAMRDTNNKYVLTLNKFSKENEGYYFCSVISNSVMYFSSVVPVLQKVNSTTTKPVLRTPSPVHPTGTSQPQRPEDCRPRGSVKGTGLDFACDIY Gene ID Swiss Prot Synonyms Ly-2; Ly-B; Ly-35; Lyt-2 Calculated MW 27KDa Observed MW Refer to figures Applications
Reactivity Mouse Tested applications FC Recommended dilution - FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.03% proclin300, 0.2% BSA, 50% glycerol, pH7.3.Key application Flow Cytometry Positive samples Cellular location Cell membrane, Single-pass type I membrane protein 
Flow cytometry: 1X10^6 C57BL/6 mouse Splenocytes were surface-stained with ABflo® 488 Rabbit anti-Mouse CD8a mAb(A23903, 5 μl/Test, orange line) or ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, blue line).Non-fluorescently stained C57BL/6 mouse Splenocytes were used as blank control (red line).
Flow cytometry:1X10^6 C57BL/6 mouse Splenocytes were surface-stained with ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, left) or ABflo® 488 Rabbit anti-Mouse CD8a mAb(A23903, 5 μl/Test, right).
-
Key applications Flow Cytometry Host species Кролик Antibody type Primary Antibodies Reactivity Мышь Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 28-196 of mouse CD8a (NP_001074579.1). Isotype IgG