быстрая доставка ~4 недели
Размер
- 100 T
- 200 T
- 500 T
ABflo® 647 Rabbit anti-Mouse CD83 mAb (A23907)
- Описание
- Характеристики
-
Overview
Product name ABflo® 647 Rabbit anti-Mouse CD83 mAb Catalog No. A23907 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC61465-ABflo647 Background
Acts upstream of or within positive regulation of CD4-positive, alpha-beta T cell differentiation; regulation of cytokine production; and response to organic cyclic compound. Located in external side of plasma membrane. Is expressed in alimentary system; genitourinary system; hemolymphoid system gland; and nervous system. Orthologous to human CD83 (CD83 molecule).Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 22-133 of mouse CD83 (NP_033986.1). Sequence MREVTVACSETADLPCTAPWDPQLSYAVSWAKVSESGTESVELPESKQNSSFEAPRRRAYSLTIQNTTICSSGTYRCALQELGGQRNLSGTVVLKVTGCPKEATESTFRKYR Gene ID Swiss Prot Synonyms mCD83 Calculated MW 21KDa Observed MW Applications
Reactivity Mouse Tested applications FC Recommended dilution - FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.03% proclin300, 0.2% BSA, 50% glycerol, pH7.3.Key application Flow Cytometry Positive samples Cellular location Membrane 
Flow cytometry: 1X10^6 293F cells(negative control, left) and 293F(Transfection, right) cells were surface-stained with ABflo® 647 Rabbit anti-Mouse CD83 mAb(A23907, 5 μl/Test, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, blue line).Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry:1X10^6 293F(Transfection) cells were surface-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, left) or ABflo® 647 Rabbit anti-Mouse CD83 mAb(A23907, 5 μl/Test, right).
-
Key applications Flow Cytometry Host species Кролик Antibody type Primary Antibodies Reactivity Мышь Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 22-133 of mouse CD83 (NP_033986.1). Isotype IgG







