быстрая доставка ~4 недели
Размер
- 100 T
- 200 T
- 500 T
ABflo® 594 Rabbit anti-Human CD71 mAb (A24257)
- Описание
- Характеристики
-
Overview
Product name ABflo® 594 Rabbit anti-Human CD71 mAb Catalog No. A24257 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC54394-ABflo594 Background
This gene encodes a cell surface receptor necessary for cellular iron uptake by the process of receptor-mediated endocytosis. This receptor is required for erythropoiesis and neurologic development. Multiple alternatively spliced variants have been identified.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 100-250 of human CD71 (NP_003225.2). Sequence RLAGTESPVREEPGEDFPAARRLYWDDLKRKLSEKLDSTDFTGTIKLLNENSYVPREAGSQKDENLALYVENQFREFKLSKVWRDQHFVKIQVKDSAQNSVIIVDKNGRLVYLVENPGGYVAYSKAATVTGKLVHANFGTKKDFEDLYTPV Gene ID Swiss Prot Synonyms T9; TR; TFR; p90; CD71; TFR1; TRFR; IMD46 Calculated MW 38kDa Observed MW Refer to figures Applications
Reactivity Human Tested applications FC Recommended dilution - FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.03% proclin300, 0.2% BSA, 50% glycerol, pH7.3.Key application Flow Cytometry Positive samples Cellular location Cell membrane, Single-pass type II membrane protein, Melanosome, Secreted (serum form) 
Flow cytometry: 1X10^6 SH-SY5Y cells (low Expression, left) and K-562 cells (right) were surface-stained with ABflo® 594 Rabbit anti-Human CD71 mAb(A24257, 5 μl/Test, orange line) or ABflo® 594 Rabbit IgG isotype control (A23821, 5 μl/Test, blue line).Non-fluorescently stained cells were used as blank control (red line).
Flow cytometry:1X10^6 K562 were surface-stained with ABflo® 594 Rabbit IgG isotype control (A23821, 5 μl/Test, left) or ABflo® 594 Rabbit anti-Human CD71 mAb(A24257, 5 μl/Test, right).
-
Key applications Flow Cytometry Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 100-250 of human CD71 (NP_003225.2). Isotype IgG