быстрая доставка ~4 недели
Размер
- 100 T
- 200 T
- 500 T
ABflo® 488 Rabbit anti-Human EGFR mAb (A24265)
- Описание
- Характеристики
-
Overview
Product name ABflo® 488 Rabbit anti-Human EGFR mAb Catalog No. A24265 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC61443-ABflo488 Background
The protein encoded by this gene is a transmembrane glycoprotein that is a member of the protein kinase superfamily. This protein is a receptor for members of the epidermal growth factor family. EGFR is a cell surface protein that binds to epidermal growth factor. Binding of the protein to a ligand induces receptor dimerization and tyrosine autophosphorylation and leads to cell proliferation. Mutations in this gene are associated with lung cancer.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to aminoacids 335-525 of human EGFR(NP_005219.2). Sequence KVCNGIGIGEFKDSLSINATNIKHFKNCTSISGDLHILPVAFRGDSFTHTPPLDPQELDILKTVKEITGFLLIQAWPENRTDLHAFENLEIIRGRTKQHGQFSLAVVSLNITSLGLRSLKEISDGDVIISGNKNLCYANTINWKKLFGTSGQKTKIISNRGENSCKATGQVCHALCSPEGCWGPEPRDCVS Gene ID Swiss Prot Synonyms EGFR; ERBB; ERBB1; HER1; NISBD2; PIG61; mENA; epidermal growth factor receptor Calculated MW 44kDa/69kDa/77kDa/134kDa Observed MW Applications
Reactivity Human Tested applications FC Recommended dilution - FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.03% proclin300, 0.2% BSA, 50% glycerol, pH7.3.Key application Flow Cytometry Positive samples Cellular location Cell membrane, Endoplasmic reticulum membrane, Endosome, Endosome membrane, Golgi apparatus membrane, Nucleus membrane, Nucleus, Secreted, Single-pass type I membrane protein 
Flow cytometry: 1X10^6 Jurkat cells (negative control, left) and A-431 cells (right) were surface-stained with ABflo® 488 Rabbit anti-Human EGFR mAb(A24265, 5 μl/Test, orange line) or ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, blue line).Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry:1X10^6 A-431 cells were surface-stained with ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, left) or ABflo® 488 Rabbit anti-Human EGFR mAb(A24265, 5 μl/Test, right).
-
Key applications Flow Cytometry Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen Recombinant fusion protein containing a sequence corresponding to aminoacids 335-525 of human EGFR(NP_005219.2). Isotype IgG







