быстрая доставка ~4 недели
Размер
- 100 T
- 200 T
- 500 T
ABflo® 488 Rabbit anti-Human IL9 mAb (A24306)
- Описание
- Характеристики
-
Overview
Product name ABflo® 488 Rabbit anti-Human IL9 mAb Catalog No. A24306 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC62039-ABflo488 Background
The protein encoded by this gene is a cytokine that acts as a regulator of a variety of hematopoietic cells. This cytokine stimulates cell proliferation and prevents apoptosis. It functions through the interleukin 9 receptor (IL9R), which activates different signal transducer and activator (STAT) proteins and thus connects this cytokine to various biological processes. The gene encoding this cytokine has been identified as a candidate gene for asthma. Genetic studies on a mouse model of asthma demonstrated that this cytokine is a determining factor in the pathogenesis of bronchial hyperresponsiveness.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to aminoacids 19-144 of human IL9(NP_000581.1). Sequence QGCPTLAGILDINFLINKMQEDPASKCHCSANVTSCLCLGIPSDNCTRPCFSERLSQMTNTTMQTRYPLIFSRVKKSVEVLKNNKCPYFSCEQPCNQTTAGNALTFLKSLLEIFQKEKMRGMRGKI Gene ID Swiss Prot Synonyms IL9; HP40; IL-9; P40; interleukin-9 Calculated MW 15kDa Observed MW Applications
Reactivity Human Tested applications FC FC(Intra) Recommended dilution - FC(Intra) 5 μl per 10^6 cells in 100 μl volume
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.03% proclin300, 0.2% BSA, 50% glycerol, pH7.3.Key application Positive samples Cellular location Secreted 
Flow cytometry:1X10^6 293T cells (negative control, left) and 293T(Transfection, right) cells were intracellularly-stained with ABflo® 488 Rabbit anti-Human IL9 mAb(A24306, 5 μl/Test, orange line) or ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry:1X10^6 293T(Transfection) cells were intracellularly-stained with ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, left) or ABflo® 488 Rabbit anti-Human IL9 mAb(A24306, 5 μl/Test, right).
-
Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen Recombinant fusion protein containing a sequence corresponding to aminoacids 19-144 of human IL9(NP_000581.1). Isotype IgG







