быстрая доставка ~4 недели
Размер
- 100 T
- 200 T
- 500 T
ABflo® 594 Rabbit anti-Human CD79A mAb (A24330)
- Описание
- Характеристики
-
Overview
Product name ABflo® 594 Rabbit anti-Human CD79A mAb Catalog No. A24330 Host species Rabbit Purification method Affinity purification Isotype IgG Background
The B lymphocyte antigen receptor is a multimeric complex that includes the antigen-specific component, surface immunoglobulin (Ig). Surface Ig non-covalently associates with two other proteins, Ig-alpha and Ig-beta, which are necessary for expression and function of the B-cell antigen receptor. This gene encodes the Ig-alpha protein of the B-cell antigen component. Alternatively spliced transcript variants encoding different isoforms have been described.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 165-225 of human CD79a (NP_001774.1). Sequence FRKRWQNEKLGLDAGDEYEDENLYEGLNLDDCSMYEDISRGLQGTYQDVGSLNIGDVQLEK Gene ID Swiss Prot Synonyms CD79A; IGA; MB-1; CD79a molecule Calculated MW 20kDa/25kDa Observed MW Refer to figures Applications
Reactivity Human Tested applications FC Recommended dilution - FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.03% proclin300, 0.2% BSA, 50% glycerol, pH7.3.Key application Flow Cytometry Positive samples Cellular location Cell membrane, Single-pass type I membrane protein 
Flow cytometry:1X10^6 Jurkat cells (negative control, left) and Daudi cells (right) were surface-stained with ABflo® 594 Rabbit anti-Human CD79A mAb(A24330, 5 μl/Test, orange line) or ABflo® 594 Rabbit IgG isotype control (A23821, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry:1X10^6 Daudi cells were surface-stained with ABflo® 594 Rabbit IgG isotype control (A23821, 5 μl/Test, left) or ABflo® 594 Rabbit anti-Human CD79A mAb(A24330, 5 μl/Test, right).
-
Key applications Flow Cytometry Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 165-225 of human CD79a (NP_001774.1). Isotype IgG







