- 100 T
- 200 T
- 500 T
- Описание
- Характеристики
-
Overview
Product name ABflo® 647 Rabbit anti-Human OPN1LW/OPN1MW mAb Catalog No. A24371 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC62189-ABflo647 Background
This gene encodes for a light absorbing visual pigment of the opsin gene family. The encoded protein is called red cone photopigment or long-wavelength sensitive opsin. Opsins are G-protein coupled receptors with seven transmembrane domains, an N-terminal extracellular domain, and a C-terminal cytoplasmic domain. This gene and the medium-wavelength opsin gene are tandemly arrayed on the X chromosome and frequent unequal recombination and gene conversion may occur between these sequences. X chromosomes may have fusions of the medium- and long-wavelength opsin genes or may have more than one copy of these genes. Defects in this gene are the cause of partial, protanopic colorblindness. This gene encodes for a light absorbing visual pigment of the opsin gene family. The encoded protein is called green cone photopigment or medium-wavelength sensitive opsin. Opsins are G-protein coupled receptors with seven transmembrane domains, an N-terminal extracellular domain, and a C-terminal cytoplasmic domain. The long-wavelength opsin gene and multiple copies of the medium-wavelength opsin gene are tandemly arrayed on the X chromosome and frequent unequal recombination and gene conversion may occur between these sequences. X chromosomes may have fusions of the medium- and long-wavelength opsin genes or may have more than one copy of these genes. Defects in this gene are the cause of deutanopic colorblindness.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-48 of human OPN1LW/OPN1MW (NP_064445.2). Sequence MAQQWSLQRLAGRHPQDSYEDSTQSSIFTYTNSNSTRGPFEGPNYHIA Gene ID Swiss Prot Synonyms CBP; RCP; ROP; CBBM; COD5; CBD; GCP; GOP; CBBM; COD5; OPN1MW1 Calculated MW 40kDa Observed MW Applications
Reactivity Human Tested applications FC Recommended dilution - FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.03% proclin300, 0.2% BSA, 50% glycerol, pH7.3.Key application Flow Cytometry Positive samples Cellular location Membrane 
Flow cytometry: 1X10^6 293F cells (negative control, left) and 293F (Transfection, right) cells were surface-stained with ABflo® 647 Rabbit anti-Human OPN1LW/OPN1MW mAb (A24371, 5 μl/Test, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry: 1X10^6 293F cells (negative control, left) and 293F (Transfection, right) cells were surface-stained with ABflo® 647 Rabbit anti-Human OPN1LW/OPN1MW mAb (A24371, 5 μl/Test, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry: 1X10^6 293F (Transfection) cells were surface-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, left) or ABflo®647 Human Rabbit anti-OPN1LW/OPN1MW mAb (A24371, 5 μl/Test, right).

Flow cytometry: 1X10^6 293F (Transfection) cells were surface-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, left) or ABflo®647 Human Rabbit anti-OPN1LW/OPN1MW mAb (A24371, 5 μl/Test, right).
-
Key applications Flow Cytometry Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-48 of human OPN1LW/OPN1MW (NP_064445.2). Isotype IgG







