быстрая доставка ~4 недели
Размер
- 100 T
- 200 T
- 500 T
ABflo® 647 Rabbit anti-Human CD270/HVEM mAb (A24418)
- Описание
- Характеристики
-
Overview
Product name ABflo® 647 Rabbit anti-Human CD270/HVEM mAb Catalog No. A24418 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC62197-ABflo647 Background
This gene encodes a member of the TNF (tumor necrosis factor) receptor superfamily. The encoded protein functions in signal transduction pathways that activate inflammatory and inhibitory T-cell immune response. It binds herpes simplex virus (HSV) viral envelope glycoprotein D (gD), mediating its entry into cells. Alternative splicing results in multiple transcript variants.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 39-162 of human CD270/HVEM(NP_003811.2) Sequence LPSCKEDEYPVGSECCPKCSPGYRVKEACGELTGTVCEPCPPGTYIAHLNGLSKCLQCQMCDPAMGLRASRNCSRTENAVCGCSPGHFCIVQDGDHCAACRAYATSSPGQRVQKGGTESQDTLC Gene ID Swiss Prot Synonyms TNFRSF14; ATAR; CD270; HVEA; HVEM; LIGHTR; TR2; TNF receptor superfamily member 14 Calculated MW 21kDa/30kDa Observed MW Refer to figures Applications
Reactivity Human Tested applications FC Recommended dilution - FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.03% proclin300, 0.2% BSA, 50% glycerol, pH7.3.Key application Flow Cytometry Positive samples Cellular location Membrane, Single-pass type I membrane protein 
Flow cytometry:1X10^6 HAP1 cells (negative control, left) and HEL cells (right) were surface-stained with ABflo® 647 Rabbit anti-Human CD270/HVEM mAb(A24418, 5 μl/Test, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry:1X10^6 HEL cells were surface-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, left) or ABflo® 647 Rabbit anti-Human CD270/HVEM mAb(A24418, 5 μl/Test, right).
-
Key applications Flow Cytometry Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 39-162 of human CD270/HVEM(NP_003811.2) Isotype IgG







