быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
14-3-3 beta/zeta Rabbit mAb (A9152)
- Описание
- Характеристики
-
Overview
Product name 14-3-3 beta/zeta Rabbit mAb Catalog No. A9152 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1454 Background
This gene encodes a protein belonging to the 14-3-3 family of proteins, members of which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals. The encoded protein has been shown to interact with RAF1 and CDC25 phosphatases, suggesting that it may play a role in linking mitogenic signaling and the cell cycle machinery. Two transcript variants, which encode the same protein, have been identified for this gene. [provided by RefSeq, Jul 2008]Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human 14-3-3 beta/zeta (P31946). Sequence MTMDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVL Gene ID Swiss Prot Synonyms GW128; HEL-S-1; HS1; KCIP-1; YWHAA; 14-3-3 Calculated MW 28kDa Observed MW 28kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IF/ICC Recommended dilution - WB 1:500 - 1:1000
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples HT-29, A-549, NIH/3T3, Jurkat, Mouse lung, Mouse kidney, Rat spleen Cellular location cytoplasm, cytosol, extracellular exosome, focal adhesion, melanosome, perinuclear region of cytoplasm 
Western blot analysis of extracts of various cell lines, using 14-3-3 beta/zeta Rabbit mAb (A9152) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Immunofluorescence analysis of NIH-3T3 cells using 14-3-3 beta/zeta Rabbit mAb (A9152) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human 14-3-3 beta/zeta (P31946). Isotype IgG