быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
ADAMTS13 Rabbit mAb (A3370)
- Описание
- Характеристики
-
Overview
Product name ADAMTS13 Rabbit mAb Catalog No. A3370 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1957 Background
This gene encodes a member of a family of proteins containing several distinct regions, including a metalloproteinase domain, a disintegrin-like domain, and a thrombospondin type 1 (TS) motif. The enzyme encoded by this gene specifically cleaves von Willebrand Factor (vWF). Defects in this gene are associated with thrombotic thrombocytopenic purpura. Alternative splicing results in multiple transcript variants.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 50-150 of human ADAMTS13 (Q76LX8). Sequence LSPGAPLKGRPPSPGFQRQRQRQRRAAGGILHLELLVAVGPDVFQAHQEDTERYVLTNLNIGAELLRDPSLGAQFRVHLVKMVILTEPEGAPNITANLTSS Gene ID Swiss Prot Synonyms VWFCP; C9orf8; vWF-CP; ADAM-TS13; ADAMTS-13 Calculated MW 154kDa Observed MW 190kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IF/ICC Recommended dilution - WB 1:500 - 1:1000
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples Mouse liver, Mouse spleen, Mouse plasma, Rat plasma Cellular location Cell surface, Endoplasmic reticulum lumen, Extracellular space 
Western blot analysis of extracts of various cell lines, using ADAMTS13 antibody (A3370) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.
Immunofluorescence analysis of rat liver using ADAMTS13 Rabbit mAb (A3370) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of human liver using ADAMTS13 Rabbit mAb (A3370) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of mouse liver using ADAMTS13 Rabbit mAb (A3370) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 50-150 of human ADAMTS13 (Q76LX8). Isotype IgG