быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
ABHD5 Rabbit mAb (A8673)
- Описание
- Характеристики
-
Overview
Product name ABHD5 Rabbit mAb Catalog No. A8673 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1777 Background
The protein encoded by this gene belongs to a large family of proteins defined by an alpha/beta hydrolase fold, and contains three sequence motifs that correspond to a catalytic triad found in the esterase/lipase/thioesterase subfamily. It differs from other members of this subfamily in that its putative catalytic triad contains an asparagine instead of the serine residue. Mutations in this gene have been associated with Chanarin-Dorfman syndrome, a triglyceride storage disease with impaired long-chain fatty acid oxidation.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 100-200 of human ABHD5 (Q8WTS1). Sequence TNRPVYAFDLLGFGRSSRPRFDSDAEEVENQFVESIEEWRCALGLDKMILLGHNLGGFLAAAYSLKYPSRVNHLILVEPWGFPERPDLADQDRPIPVWIRA Gene ID Swiss Prot Synonyms CGI58; IECN2; NCIE2 Calculated MW 39kDa Observed MW 42kDa Applications
Reactivity Human, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples HepG2, RD, Rat liver, Rat testis Cellular location Cytoplasm, Lipid droplet 
Western blot analysis of extracts of various cell lines, using ABHD5 Rabbit mAb (A8673) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 100-200 of human ABHD5 (Q8WTS1). Isotype IgG