быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
Adenosine Deaminase (ADA) Rabbit mAb (A5151)
- Описание
- Характеристики
-
Overview
Product name Adenosine Deaminase (ADA) Rabbit mAb Catalog No. A5151 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1152 Background
This gene encodes an enzyme that catalyzes the hydrolysis of adenosine to inosine in the purine catabolic pathway. Various mutations have been described for this gene and have been linked to human diseases related to impaired immune function such as severe combined immunodeficiency disease (SCID) which is the result of a deficiency in the ADA enzyme. In ADA-deficient individuals there is a marked depletion of T, B, and NK lymphocytes, and consequently, a lack of both humoral and cellular immunity. Conversely, elevated levels of this enzyme are associated with congenital hemolytic anemia.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 250-350 of human Adenosine Deaminase (ADA) (NP_000013.2). Sequence NRLRQENMHFEICPWSSYLTGAWKPDTEHAVIRLKNDQANYSLNTDDPLIFKSTLDTDYQMTKRDMGFTEEEFKRLNINAAKSSFLPEDEKRELLDLLYKA Gene ID Swiss Prot Synonyms ADA1 Calculated MW 41kDa Observed MW 41kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples Jurkat, Mouse stomach, Rat thymus, Rat lung Cellular location Cell junction, Cell membrane, Cytoplasm, Cytoplasmic vesicle lumen, Extracellular side, Peripheral membrane protein 
Western blot analysis of various lysates, using Adenosine Deaminase (ADA) Rabbit mAb (A5151) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.
Western blot analysis of Mouse stomach, using Adenosine Deaminase (ADA) Rabbit mAb (A5151) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 45s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 250-350 of human Adenosine Deaminase (ADA) (NP_000013.2). Isotype IgG