быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
15-PGDH/HPGD Rabbit mAb (A5024)
- Описание
- Характеристики
-
Overview
Product name 15-PGDH/HPGD Rabbit mAb Catalog No. A5024 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1280 Background
This gene encodes a member of the short-chain nonmetalloenzyme alcohol dehydrogenase protein family. The encoded enzyme is responsible for the metabolism of prostaglandins, which function in a variety of physiologic and cellular processes such as inflammation. Mutations in this gene result in primary autosomal recessive hypertrophic osteoarthropathy and cranioosteoarthropathy. Multiple transcript variants encoding different isoforms have been found for this gene.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 50-151 of human 15-PGDH/HPGD (P15428). Sequence DEQFEPQKTLFIQCDVADQQQLRDTFRKVVDHFGRLDILVNNAGVNNEKNWEKTLQINLVSVISGTYLGLDYMSKQNGGEGGIIINMSSLAGLMPVAQQPVY Gene ID Swiss Prot Synonyms PGDH; PGDH1; PHOAR1; 15-PGDH; SDR36C1 Calculated MW 29kDa Observed MW 29kDa Applications
Reactivity Mouse, Rat Tested applications WB IF/ICC Recommended dilution - WB 1:500 - 1:2000
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples Rat lung, Rat kidney Cellular location Cytoplasm 
Western blot analysis of extracts of various cell lines, using 15-PGDH/HPGD Rabbit mAb (A5024) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
Immunofluorescence analysis of C6 cells using 15-PGDH/HPGD Rabbit mAb (A5024) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of NIH-3T3 cells using 15-PGDH/HPGD Rabbit mAb (A5024) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 50-151 of human 15-PGDH/HPGD (P15428). Isotype IgG