![[KD Validated] ABCA6 Rabbit pAb (A21243)](/upload/resize_cache/iblock/96c/340_340_140cd750bba9870f18aada2478b24840a/9seby0i8o5a4yx24dji1o3jgbw8w65r3.jpg "[KD Validated] ABCA6 Rabbit pAb (A21243)")
быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
[KD Validated] ABCA6 Rabbit pAb (A21243)
- Описание
- Характеристики
-
Overview
Product name [KD Validated] ABCA6 Rabbit pAb Catalog No. A21243 Host species Rabbit Purification method Affinity purification Isotype IgG Background
The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intracellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, and White). This encoded protein is a member of the ABC1 subfamily. Members of the ABC1 subfamily comprise the only major ABC subfamily found exclusively in multicellular eukaryotes. This gene is clustered among 4 other ABC1 family members on 17q24 and may play a role in macrophage lipid homeostasis.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1518-1617 of human ABCA6 (NP_525023.2). Sequence SQVTLVHTEILKLFPQAAGQERYSSLLTYKLPVADVYPLSQTFHKLEAVKHNFNLEEYSLSQCTLEKVFLELSKEQEVGNFDEEIDTTMRWKLLPHSDEP Gene ID Swiss Prot Synonyms EST155051 Calculated MW 184kDa Observed MW 180kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.Key application Western blotting Positive samples 293T, RAW264.7, Mouse liver, Rat liver Cellular location Membrane, Multi-pass membrane protein 
Western blot analysis of extracts of various cell lines, using ABCA6 antibody (A21243) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Western blot analysis of extracts from wild type(WT) and ABCA6 knockdown (KD) 293T cells, using ABCA6 antibody (A21243) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1518-1617 of human ABCA6 (NP_525023.2). Isotype IgG