быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
ACSL1 Rabbit pAb (A16253)
- Описание
- Характеристики
-
Overview
Product name ACSL1 Rabbit pAb Catalog No. A16253 Host species Rabbit Purification method Affinity purification Isotype IgG Background
The protein encoded by this gene is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. Several transcript variants encoding different isoforms have been found for this gene.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 46-145 of human ACSL1 (NP_001986.2). Sequence TRPKPLKPPCDLSMQSVEVAGSGGARRSALLDSDEPLVYFYDDVTTLYEGFQRGIQVSNNGPCLGSRKPDQPYEWLSYKQVAELSECIGSALIQKGFKTA Gene ID Swiss Prot Synonyms ACS1; LACS; FACL1; FACL2; LACS1; LACS2 Calculated MW 78kDa Observed MW 78kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IF/ICC IP Recommended dilution - WB 1:500 - 1:1000
- IF/ICC 1:50 - 1:200
- IP 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Immunoprecipitation Positive samples Raji, Mouse kidney, Rat heart Cellular location Endoplasmic reticulum membrane, Microsome membrane, Mitochondrion outer membrane, Peroxisome membrane, Single-pass type III membrane protein Customer validation IF(Mus musculus)
WB(Rattus norvegicus, Mus musculus)
Western blot analysis of extracts of various cell lines, using ACSL1 antibody (A16253) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Immunofluorescence analysis of HeLa cells using ACSL1 Rabbit pAb (A16253) at dilution of 1:200 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of HepG2 cells using ACSL1 Rabbit pAb (A16253) at dilution of 1:200 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of rat kidney using ACSL1 Rabbit pAb (A16253) at dilution of 1:200 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of mouse kidney using ACSL1 Rabbit pAb (A16253) at dilution of 1:200 (40x lens). Blue: DAPI for nuclear staining.
Immunoprecipitation analysis of 300 μg extracts of Raji cells using 3 μg ACSL1 Rabbit pAb (A16253). Western blot was performed from the immunoprecipitate using ACSL1 Rabbit pAb (A16253) at a dilition of 1:1000.
-
Key applications Western blotting, Immunofluorescence, Immunoprecipitation Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 46-145 of human ACSL1 (NP_001986.2). Isotype IgG