быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
ADCY3 Rabbit pAb (A7870)
- Описание
- Характеристики
-
Overview
Product name ADCY3 Rabbit pAb Catalog No. A7870 Host species Rabbit Purification method Affinity purification Isotype IgG Background
This gene encodes adenylyl cyclase 3 which is a membrane-associated enzyme and catalyzes the formation of the secondary messenger cyclic adenosine monophosphate (cAMP). This protein appears to be widely expressed in various human tissues and may be involved in a number of physiological and pathophysiological metabolic processes. Two transcript variants encoding different isoforms have been found for this gene.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-80 of human ADCY3 (NP_004027.2). Sequence MPRNQGFSEPEYSAEYSAEYSVSLPSDPDRGVGRTHEISVRNSGSCLCLPRFMRLTFVPESLENLYQTYFKRQRHETLLV Gene ID Swiss Prot Synonyms AC3; AC-III; BMIQ19 Calculated MW 129kDa Observed MW 150-170kDa Applications
Reactivity Human, Mouse Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.Key application Western blotting Positive samples SH-SY5Y, 293T, HepG2, MCF7, Mouse brain Cellular location Cell membrane, Cell projection, Cytoplasm, Golgi apparatus, Multi-pass membrane protein, cilium 
Western blot analysis of extracts of various cell lines, using ADCY3 antibody (A7870) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 60s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-80 of human ADCY3 (NP_004027.2). Isotype IgG