быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
ACTC1 Rabbit pAb (A6507)
- Описание
- Характеристики
-
Overview
Product name ACTC1 Rabbit pAb Catalog No. A6507 Host species Rabbit Purification method Affinity purification Isotype IgG Background
Actins are highly conserved proteins that are involved in various types of cell motility. Polymerization of globular actin (G-actin) leads to a structural filament (F-actin) in the form of a two-stranded helix. Each actin can bind to four others. The protein encoded by this gene belongs to the actin family which is comprised of three main groups of actin isoforms, alpha, beta, and gamma. The alpha actins are found in muscle tissues and are a major constituent of the contractile apparatus. Defects in this gene have been associated with idiopathic dilated cardiomyopathy (IDC) and familial hypertrophic cardiomyopathy (FHC).Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human ACTC1 (NP_005150.1). Sequence MCDDEETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAP Gene ID Swiss Prot Synonyms ACTC; ASD5; CMD1R; CMH11; LVNC4 Calculated MW 42kDa Observed MW 42kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P Recommended dilution - WB 1:500 - 1:1000
- IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Positive samples C2C12, H9C2, RD, Mouse lung, Mouse heart, Rat lung, Rat heart Cellular location Cytoplasm, cytoskeleton 
Western blot analysis of extracts of various cell lines, using ACTC1 antibody (A6507) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Immunohistochemistry analysis of paraffin-embedded Human skeletal muscle using ACTC1 Rabbit pAb (A6507) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
-
Key applications Western blotting, Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human ACTC1 (NP_005150.1). Isotype IgG