быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
ACTN3 Rabbit pAb (A12864)
- Описание
- Характеристики
-
Overview
Product name ACTN3 Rabbit pAb Catalog No. A12864 Host species Rabbit Purification method Affinity purification Isotype IgG Background
This gene encodes a member of the alpha-actin binding protein gene family. The encoded protein is primarily expressed in skeletal muscle and functions as a structural component of sarcomeric Z line. This protein is involved in crosslinking actin containing thin filaments. An allelic polymorphism in this gene results in both coding and non-coding variants; the reference genome represents the coding allele. The non-functional allele of this gene is associated with elite athlete status.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 580-630 of human ACTN3 (NP_001095.2). Sequence GAIMGIQGEIQKICQTYGLRPCSTNPYITLSPQDINTKWDMVRKLVPSCDQ Gene ID Swiss Prot Synonyms ACTN3D Calculated MW 103kDa Observed MW 103kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:1000 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.Key application Western blotting Positive samples LO2, Mouse skeletal muscle, Rat skeletal muscle Cellular location cortical actin cytoskeleton, cytosol, extracellular exosome, plasma membrane, Z disc 
Western blot analysis of extracts of various cell lines, using ACTN3 antibody (A12864) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 580-630 of human ACTN3 (NP_001095.2). Isotype IgG