быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
γ-Tubulin Rabbit pAb (A14554)
- Описание
-
Overview
Product name γ-Tubulin Rabbit pAb Catalog No. A14554 Host species Rabbit Purification method Affinity purification Isotype IgG Background
This gene encodes a member of the tubulin superfamily. The encoded protein localizes to the centrosome where it binds to microtubules as part of a complex referred to as the gamma-tubulin ring complex. The protein mediates microtubule nucleation and is required for microtubule formation and progression of the cell cycle. A pseudogene of this gene is found on chromosome 7.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 350-450 of human γ-Tubulin (NP_001061.2). Sequence PWGPASIQVALSRKSPYLPSAHRVSGLMMANHTSISSLFERTCRQYDKLRKREAFLEQFRKEDMFKDNFDEMDTSREIVQQLIDEYHAATRPDYISWGTQE Gene ID Swiss Prot Synonyms TUBG1; CDCBM4; GCP-1; TUBG; TUBGCP1 Calculated MW 51kDa Observed MW 51kDa Applications
Reactivity Human, Mouse, Rat Tested applications WBIHCICCIFIPChIPChIP-seqRIPFCELISAMeDIPNucleotide ArrayDBFACSCoIP Recommended dilution WB 1:500 - 1:2000
IF 1:50 - 1:200Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples MCF7, HeLa, Mouse brain, Mouse lung, Rat brain Cellular location Cytoplasm, centrosome, cytoskeleton, microtubule organizing center γ-Tubulin Rabbit pAb images
Western blot - γ-Tubulin Rabbit pAb (A14554)
Western blot analysis of extracts of various cell lines, using γ-Tubulin antibody (A14554) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.* For research use only. Not for therapeutic or diagnostic purposes.
Product Protocols